Germany
Japan
United Kingdom
China
REEP4 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 228-257 amino acids from the C-terminal region of Human REEP4. |
Antibodies
View as table Download
Rabbit Polyclonal REEP4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | REEP4 antibody was raised against a 17 amino acid peptide near the center of human REEP4. |
Rabbit Polyclonal Anti-REEP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REEP4 antibody: synthetic peptide directed towards the N terminal of human REEP4. Synthetic peptide located within the following region: EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE |
Active filters
Target Symbol
- REEP4