Antibodies

View as table Download

RGS3 mouse monoclonal antibody, clone 1E8-C7, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit polyclonal anti-RGS3 antibody

Applications WB
Reactivities Human
Immunogen E. coli-expressed human RGS3

Rabbit Polyclonal Anti-RGS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Rabbit Polyclonal Anti-RGS3 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL