Rabbit Polyclonal Anti-RHBG Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHBG antibody: synthetic peptide directed towards the C terminal of human RHBG. Synthetic peptide located within the following region: LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG |
Goat Anti-RHBG (mouse) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PLRGGESDTR, from the C Terminus of the protein sequence according to NP_067350.2. |
Rabbit Polyclonal Anti-RHBG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHBG antibody: synthetic peptide directed towards the N terminal of human RHBG. Synthetic peptide located within the following region: RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR |
RHBG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RHBG (NP_065140.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
