RHBG Rabbit Polyclonal Antibody

CAT#: TA338417

Rabbit Polyclonal Anti-RHBG Antibody

Product Images

WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate. RHBG is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RHBG antibody: synthetic peptide directed towards the C terminal of human RHBG. Synthetic peptide located within the following region: LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: Rh family B glycoprotein (gene/pseudogene)
• Database Link:
  NP_065140
  Entrez Gene 57127 Human
  UniProt ID Q9H310
• Background: RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1309 AF193807.1 1-1309 1310-1310 AL139130.28 4265-4265 1311-1806 AF193807.1 1310-1805
• Synonyms: SLC42A2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Horse: 86%; Dog: 79%

Reference Data

• Protein Families: Transmembrane