Rabbit Polyclonal Anti-ZNF179 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the middle region of human ZNF179. Synthetic peptide located within the following region: REFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCK |
Rabbit Polyclonal Anti-ZNF179 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the C terminal of human ZNF179. Synthetic peptide located within the following region: GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRFCGHLAAVGGAVGAGL |
RNF112 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-500 of human RNF112 (NP_009079.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China