ZNF179 (RNF112) Rabbit Polyclonal Antibody

CAT#: TA334755

Rabbit Polyclonal Anti-ZNF179 Antibody

Product Images

WB Suggested Anti-ZNF179 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the middle region of human ZNF179. Synthetic peptide located within the following region: REFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: ring finger protein 112
• Database Link:
  NP_009079
  Entrez Gene 7732 Human
  UniProt ID Q9ULX5
• Background: The specific function of this protein remains unknown.This gene encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Synonyms: BFP; ZNF179
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane