Antibodies

View as table Download

Rabbit Polyclonal Anti-RSF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RSF1 antibody: synthetic peptide directed towards the middle region of human RSF1. Synthetic peptide located within the following region: QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK

Mouse Monoclonal Rsf1 Antibody

Applications WB
Reactivities Human

Mouse Monoclonal Rsf1 Antibody

Applications WB
Reactivities Human