Rabbit Polyclonal Anti-RALGPS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RALGPS1 antibody: synthetic peptide directed towards the middle region of human RALGPS1. Synthetic peptide located within the following region: AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL |
RALGPS1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RALGPS1 (NP_055451.1). |
| Modifications | Unmodified |
RALGPS1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RALGPS1 (NP_055451.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China