RALGPS1 Rabbit Polyclonal Antibody

CAT#: TA344101

Rabbit Polyclonal Anti-RALGPS1 Antibody

Product Images

WB Suggested Anti-RALGPS1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RALGPS1 antibody: synthetic peptide directed towards the middle region of human RALGPS1. Synthetic peptide located within the following region: AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: Ral GEF with PH domain and SH3 binding motif 1
• Database Link:
  NP_055451
  Entrez Gene 9649 Human
  UniProt ID Q5JS13
• Background: RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.
• Synonyms: RALGEF2; RALGPS1A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 76%