Antibodies

View as table Download

Rabbit Polyclonal Anti-RASSF7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RASSF7 Antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: RVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL

Rabbit Polyclonal Anti-RASSF7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RASSF7 antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY

Goat Polyclonal Antibody against RASSF7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CTDLRGLELRVQRN, from the internal region of the protein sequence according to NP_003466.1.

Rabbit Polyclonal Anti-RASSF7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RASSF7 Antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: QSAEVQGSLALVSRALEAAERALQAQAQELEELNRELRQCNLQQFIQQTG

Rabbit Polyclonal Anti-RASSF7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RASSF7