RASSF7 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1
USD 823.00
Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1
USD 396.00
Other products for "RASSF7"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RASSF7 antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | Ras association domain family member 7 |
Database Link | |
Background | The function remains unknown. |
Synonyms | C11orf13; HRAS1; HRC1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 86%; Pig: 79%; Bovine: 79%; Horse: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.