Rabbit Polyclonal Anti-RAX Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAX antibody: synthetic peptide directed towards the N terminal of human RAX. Synthetic peptide located within the following region: MHLPGCAPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKDDGILGT |
Rabbit Polyclonal Anti-RAX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAX antibody: synthetic peptide directed towards the N terminal of human RAX. Synthetic peptide located within the following region: EYEAPRPYCPKEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTF |
Carrier-free (BSA/glycerol-free) RAX mouse monoclonal antibody,clone OTI1F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAX mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAX mouse monoclonal antibody,clone OTI4F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAX mouse monoclonal antibody,clone OTI5C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAX mouse monoclonal antibody,clone OTI6C2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse RAX |
RAX mouse monoclonal antibody,clone OTI1F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI1F11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAX mouse monoclonal antibody,clone OTI1F11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAX mouse monoclonal antibody,clone OTI1F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI1C5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAX mouse monoclonal antibody,clone OTI1C5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAX mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI4F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI4F12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAX mouse monoclonal antibody,clone OTI4F12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAX mouse monoclonal antibody,clone OTI4F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI5C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI5C10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAX mouse monoclonal antibody,clone OTI5C10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAX mouse monoclonal antibody,clone OTI5C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI6C2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAX mouse monoclonal antibody,clone OTI6C2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAX mouse monoclonal antibody,clone OTI6C2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAX mouse monoclonal antibody,clone OTI6C2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
