Rabbit Polyclonal Anti-DRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DRB1 antibody: synthetic peptide directed towards the N terminal of human DRB1. Synthetic peptide located within the following region: MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD |
Rabbit Polyclonal Anti-RBM45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM45 antibody: synthetic peptide directed towards the middle region of human RBM45. Synthetic peptide located within the following region: MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT |
RBM45 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 446-476 amino acids from the C-terminal region of Human RBM45. |
RBM45 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RBM45 (NP_694453.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China