Germany
Japan
United Kingdom
China
RBM45 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of RNA binding motif protein 45 (RBM45)
USD 396.00
Other products for "RBM45"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RBM45 antibody: synthetic peptide directed towards the middle region of human RBM45. Synthetic peptide located within the following region: MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 53 kDa |
| Gene Name | RNA binding motif protein 45 |
| Database Link | |
| Background | RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains. |
| Synonyms | DRB1; RB-1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.