Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBP1 antibody: synthetic peptide directed towards the middle region of human RBP1. Synthetic peptide located within the following region: IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG |
Goat Polyclonal Antibody against RBP1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence VEGVVCKQVFKKVQ, from the C Terminus of the protein sequence according to NP_002890.1. |
RBP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RBP1 |
RBP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 63-197 of human RBP1 (NP_002890.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RBP1