Germany
Japan
United Kingdom
China
Rabbit anti-RBP4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human RBP4 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RBP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBP4 antibody: synthetic peptide directed towards the N terminal of human RBP4. Synthetic peptide located within the following region: MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP |
RBP4 mouse monoclonal antibody, clone RB42
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone RB45
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone RB48
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone RB55
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
RBP4 (169-183) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-183) KLH-conjugated (VHNGYCDGRSERNLL) |
RBP4 (169-183) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-183) KLH-conjugated (VHNGYCDGRSERNLL) |
RBP4 (169-182) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-182) KLH-conjugated (VHNGYCDGRSERNL) |
RBP4 (169-182) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-182) KLH-conjugated (VHNGYCDGRSERNL) |
RBP4 (169-181) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-181) KLH-conjugated (VHNGYCDGRSERN) |
RBP4 (169-181) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-181) KLH-conjugated (VHNGYCDGRSERN) |
RBP4 (169-179) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-179) KLH-conjugated (VHNGYCDGRSE) |
RBP4 (169-179) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-179) KLH-conjugated (VHNGYCDGRSE) |
RBP4 (169-176) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-176) KLH-conjugated (VHNGYCDG) |
RBP4 (169-176) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Synthetic Human RBP4 (aa 169-176) KLH-conjugated (VHNGYCDG) |
RBP4 (1-183) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Native Human RBP4 (aa 1-183) full length (signal peptid cleaved). |
RBP4 (1-183) rabbit polyclonal antibody, Serum
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Native Human RBP4 (aa 1-183) full length (signal peptid cleaved). |
Goat Polyclonal Antibody against RBP4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKGNDDHWIVDTDYD, from the internal region of the protein sequence according to NP_006735.2. |
Goat Polyclonal Antibody against RBP4 (Internal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DTEDPAKFKMKY, from the internal region of the protein sequence according to NP_006735.2. |
Rabbit Polyclonal Anti-RBP4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RBP4 |
RBP4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-201 of human RBP4 (NP_006735.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RBP4