Rabbit Polyclonal Anti-RDH16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RDH16 antibody: synthetic peptide directed towards the N terminal of human RDH16. Synthetic peptide located within the following region: WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDA |
Rabbit Polyclonal Anti-RDH16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RDH16 antibody: synthetic peptide directed towards the middle region of human RDH16. Synthetic peptide located within the following region: SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV |
Germany
Japan
United Kingdom
China