Retinol dehydrogenase 16 (RDH16) Rabbit Polyclonal Antibody

CAT#: TA346361

Rabbit Polyclonal Anti-RDH16 Antibody

Product Images

WB Suggested Anti-RDH16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RDH16 antibody: synthetic peptide directed towards the middle region of human RDH16. Synthetic peptide located within the following region: SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: retinol dehydrogenase 16 (all-trans)
• Database Link:
  NP_003699
  Entrez Gene 8608 Human
  UniProt ID O75452
• Background: RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.
• Synonyms: RODH-4; SDR9C8
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Horse: 79%; Rabbit: 79%

Reference Data

• Protein Pathways: Metabolic pathways, Retinol metabolism