Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RFC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the C terminal of human RFC3. Synthetic peptide located within the following region: IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF |
Rabbit Polyclonal Anti-RFC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the N terminal of human RFC3. Synthetic peptide located within the following region: YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL |
Carrier-free (BSA/glycerol-free) RFC3 mouse monoclonal antibody,clone OTI4A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RFC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human RFC3 (NP_002906.1). |
| Modifications | Unmodified |
RFC3 mouse monoclonal antibody,clone OTI4A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RFC3 mouse monoclonal antibody,clone OTI4A7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RFC3 mouse monoclonal antibody,clone OTI4A7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RFC3 mouse monoclonal antibody,clone OTI4A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RFC3