Germany
Japan
United Kingdom
China
RHEBL1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 24-53 amino acids from the N-terminal region of Human RHEBL1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Rhebl1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rhebl1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDEYSILPYSLII |
Rabbit Polyclonal Anti-RHEBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHEBL1 antibody: synthetic peptide directed towards the middle region of human RHEBL1. Synthetic peptide located within the following region: TRVPVVLVGNKADLSPEREVQAVEGKKLAESWGATFMESSARENQLTQGI |
RHEBL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RHEBL1 |
Active filters
Target Symbol
- RHEBL1