Rhebl1 Rabbit Polyclonal Antibody

CAT#: TA340329

Rabbit Polyclonal Anti-Rhebl1 Antibody

Product Images

WB Suggested Anti-Rhebl1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rhebl1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDEYSILPYSLII
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: Ras homolog enriched in brain like 1
• Database Link:
  NP_081243
  Entrez Gene 69159 Mouse
  UniProt ID Q9D8T3
• Background: Rhebl1 binds GTP and exhibits intrinsic GTPase activity. It may activate NF-kappa-B-mediated gene transcription. It promotes signal transduction through MTOR, activates RPS6KB1, and is a downstream target of the small GTPase-activating proteins TSC1 and TSC2.
• Synonyms: FLJ25797; MGC34869; Rheb2; RhebL1c
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 83%; Sheep: 83%; Zebrafish: 83%