Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RHOB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RHOB. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RHOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHOB antibody: synthetic peptide directed towards the middle region of human RHOB. Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY |
Anti-RHOB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-188 amino acids of Human Ras homolog family member B |
RhoB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human RhoB (NP_004031.1). |
| Modifications | Unmodified |
RhoB Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RhoB (NP_004031.1). |
| Modifications | Unmodified |
RhoB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RhoB (NP_004031.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RHOB