Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Brugia malayi, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Carrier-free (BSA/glycerol-free) RHOC mouse monoclonal antibody, clone OTI6F11 (formerly 6F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RHOC mouse monoclonal antibody, clone OTI6B4 (formerly 6B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RHOC mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-RHOC Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member C |
RHOC mouse monoclonal antibody, clone OTI6F11 (formerly 6F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RHOC mouse monoclonal antibody, clone OTI6F11 (formerly 6F11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RHOC mouse monoclonal antibody, clone OTI6F11 (formerly 6F11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RHOC mouse monoclonal antibody, clone OTI6F11 (formerly 6F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RHOC mouse monoclonal antibody, clone OTI3A5 (formerly 3A5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
RHOC mouse monoclonal antibody, clone OTI6B4 (formerly 6B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RHOC mouse monoclonal antibody, clone OTI6B4 (formerly 6B4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RHOC mouse monoclonal antibody, clone OTI6B4 (formerly 6B4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RHOC mouse monoclonal antibody, clone OTI6B4 (formerly 6B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RHOC mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RHOC mouse monoclonal antibody, clone OTI3C6 (formerly 3C6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RHOC mouse monoclonal antibody, clone OTI3C6 (formerly 3C6), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RHOC mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RHOC