Antibodies

Jump to Filters
View as table Download
RNF185 (Center) Rabbit Polyclonal Antibody
AP53680PU-N

USD 450.00

2 Weeks

RNF185 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Hamster, Human, Mouse
Immunogen KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of Human RN185.
RNF185 Rabbit Polyclonal Antibody
TA330506

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF185 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF185 antibody: synthetic peptide directed towards the middle region of human RNF185. Synthetic peptide located within the following region: QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF
RNF185 Rabbit Polyclonal Antibody
TA350363

USD 345.00

In Stock

Rabbit Polyclonal Anti-RNF185 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RNF185
RNF185 Rabbit Polyclonal Antibody
TA364982

USD 380.00

4 Weeks

RNF185 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RNF185
RNF185 Rabbit Polyclonal Antibody
TA380990

USD 220.00

3 Weeks

RNF185 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RNF185 (NP_689480.2).
Modifications Unmodified