RNF185 Rabbit Polyclonal Antibody

CAT#: TA330506

Rabbit Polyclonal Anti-RNF185 Antibody

Product Images

WB Suggested Anti-RNF185 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF185 antibody: synthetic peptide directed towards the middle region of human RNF185. Synthetic peptide located within the following region: QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: ring finger protein 185
• Database Link:
  NP_689480
  Entrez Gene 91445 Human
  UniProt ID Q96GF1
• Background: RNF185 is a multi-pass membrane protein. It contains 1 RING-type zinc finger.The exact function of RNF185 remains unknown.
• Synonyms: FLJ38628
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane