Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RNF20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the N terminal of human RNF20. Synthetic peptide located within the following region: LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS |
Rabbit Polyclonal Anti-RNF20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the middle region of human RNF20. Synthetic peptide located within the following region: KEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEI |
Carrier-free (BSA/glycerol-free) RNF20 mouse monoclonal antibody,clone OTI13A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RNF20 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RNF20 (NP_062538.5). |
| Modifications | Unmodified |
RNF20 mouse monoclonal antibody,clone OTI13A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RNF20 mouse monoclonal antibody,clone OTI13A10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RNF20 mouse monoclonal antibody,clone OTI13A10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RNF20 mouse monoclonal antibody,clone OTI13A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- RNF20