Rabbit Polyclonal Anti-RPS27L Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPS27L antibody: synthetic peptide directed towards the N terminal of human RPS27L. Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA |
Rps27l Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Rat Rps27l |
RPS27L rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPS27L |
RPS27L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human RPS27L (NP_057004.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
