RPS27L Rabbit Polyclonal Antibody

CAT#: TA345097

Rabbit Polyclonal Anti-RPS27L Antibody - N-terminal region

Product Images

WB Suggested Anti-RPS27L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysateRPS27L is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RPS27L antibody: synthetic peptide directed towards the N terminal of human RPS27L. Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 9 kDa
• Gene Name: ribosomal protein S27 like
• Database Link:
  NP_057004
  Entrez Gene 51065 Human
  UniProt ID Q71UM5
• Background: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. [provided by RefSeq, Jul 2008]
• Synonyms: 40S ribosomal protein S27-like; ribosomal protein S27-like
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Goat: 91%; Yeast: 79%

Reference Data

• Protein Pathways: Ribosome