RPS27L (NM_015920) Human Recombinant Protein

CAT#: TP302658

Recombinant protein of human ribosomal protein S27-like (RPS27L)

Product Images

Coomassie blue staining of purified RPS27L protein (Cat# TP302658). The protein was produced from HEK293T cells transfected with RPS27L cDNA clone (Cat# RC202658) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202658 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK
  ARLTEGCSFRRKQH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057004
• Locus ID: 51065
• UniProt ID: Q71UM5
• Cytogenetics: 15q22.2
• Refseq Size: 1084
• Refseq ORF: 252
• Summary: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. [provided by RefSeq, Jul 2008]
• Protein Pathways: Ribosome