RPS27L (NM_015920) Human Mass Spec Standard

CAT#: PH302658

RPS27L MS Standard C13 and N15-labeled recombinant protein (NP_057004)

Product Images

Coomassie blue staining of purified RPS27L protein (Cat# TP302658). The protein was produced from HEK293T cells transfected with RPS27L cDNA clone (Cat# RC202658) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202658
• Predicted MW: 9.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202658 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK
  ARLTEGCSFRRKQH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057004
• RefSeq Size: 1084
• RefSeq ORF: 252
• Synonyms: 40S ribosomal protein S27-like; ribosomal protein S27-like
• Locus ID: 51065
• UniProt ID: Q71UM5
• Cytogenetics: 15q22.2
• Summary: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. [provided by RefSeq, Jul 2008]
• Protein Pathways: Ribosome