Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-RRAD (aa36-48) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | Peptide with sequence C-HRRSMPVDERDLQ, from the internal region of the protein sequence according to NP_004156.1. |
Rabbit polyclonal Anti-RRAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RRAD antibody: synthetic peptide directed towards the middle region of human RRAD. Synthetic peptide located within the following region: LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG |
Rabbit polyclonal Anti-RRAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RRAD antibody: synthetic peptide directed towards the middle region of human RRAD. Synthetic peptide located within the following region: YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ |
Anti-RRAD Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 173-178 amino acids of human Ras-related associated with diabetes |
Active filters
Target Symbol
- RRAD