RRAD Rabbit Polyclonal Antibody

CAT#: TA342213

Rabbit polyclonal Anti-RRAD Antibody

Product Images

WB Suggested Anti-RRAD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RRAD antibody: synthetic peptide directed towards the middle region of human RRAD. Synthetic peptide located within the following region: LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: RRAD, Ras related glycolysis inhibitor and calcium channel regulator
• Database Link:
  NP_004156
  Entrez Gene 6236 Human
  UniProt ID P55042
• Background: RRAD may play an important role in cardiac antiarrhythmia viaThe strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking toThe cell membrane. RRAD inhibits cardiac hy
• Synonyms: RAD; RAD1; REM3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%