Rabbit Polyclonal Anti-RRAGD Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RRAGD antibody: synthetic peptide directed towards the middle region of human RRAGD. Synthetic peptide located within the following region: CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL |
RRAGD Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RRAGD |
RRAGD Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 181-400 of human RRAGD (NP_067067.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China