RRAGD Rabbit Polyclonal Antibody

CAT#: TA344724

Rabbit Polyclonal Anti-RRAGD Antibody - middle region

Product Images

WB Suggested Anti-RRAGD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: A549 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RRAGD antibody: synthetic peptide directed towards the middle region of human RRAGD. Synthetic peptide located within the following region: CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: Ras related GTP binding D
• Database Link:
  NP_067067
  Entrez Gene 58528 Human
  UniProt ID Q9NQL2
• Background: RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.
• Synonyms: bA11D8.2.1; RAGD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Mouse: 86%; Sheep: 77%; Zebrafish: 77%; Guinea pig: 77%