Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RTKN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RTKN Antibody: synthetic peptide directed towards the N terminal of human RTKN. Synthetic peptide located within the following region: DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG |
Rabbit Polyclonal Anti-RTKN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RTKN Antibody: synthetic peptide directed towards the middle region of human RTKN. Synthetic peptide located within the following region: IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP |
RTKN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 254-513 of human RTKN (NP_001015056.1). |
| Modifications | Unmodified |
RTKN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 254-513 of human RTKN (NP_001015056.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RTKN