Rabbit Polyclonal Anti-RTN4RL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RTN4RL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL1. Synthetic peptide located within the following region: RPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPT |
Rabbit Polyclonal Anti-RTN4RL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RTN4RL1 Antibody is: synthetic peptide directed towards the middle region of Human RTN4RL1. Synthetic peptide located within the following region: SPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDY |
RTN4RL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-420 of human RTN4RL1 (NP_848663.1). |
| Modifications | Unmodified |
Recombinant Anti-NgR1 (Clone M5)
| Applications | ELISA, FC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China