RTN4RL1 Rabbit Polyclonal Antibody

CAT#: TA331557

Rabbit Polyclonal Anti-RTN4RL1 Antibody

Product Images

Host: Rabbit; Target Name: RTN4RL1; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RTN4RL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL1. Synthetic peptide located within the following region: RPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: reticulon 4 receptor like 1
• Database Link:
  NP_848663
  Entrez Gene 146760 Human
  UniProt ID Q86UN2
• Background: RTN4RL1 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
• Synonyms: NgR3; NGRH2
• Note: Immunogen sequence homology: Human: 100%; Bovine: 86%; Dog: 79%; Pig: 79%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome