Germany
Japan
United Kingdom
China
Anti-SCCPDH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 270 amino acids of human saccharopine dehydrogenase (putative) |
Antibodies
View as table Download
SCCPDH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SCCPDH |
Rabbit Polyclonal Anti-SCCPDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SCCPDH Antibody: synthetic peptide directed towards the middle region of human SCCPDH. Synthetic peptide located within the following region: SDVSVVRRTQRYLYENLEESPVQYAAYVTVGGITSVIKLMFAGLFFLFFV |
Rabbit Polyclonal Anti-SCCPDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SCCPDH Antibody: synthetic peptide directed towards the C terminal of human SCCPDH. Synthetic peptide located within the following region: FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK |
SCCPDH rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SCCPDH |
Active filters
Target Symbol
- SCCPDH