SCCPDH Rabbit Polyclonal Antibody

CAT#: TA335576

Rabbit Polyclonal Anti-SCCPDH Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SCCPDH"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SCCPDH Antibody: synthetic peptide directed towards the middle region of human SCCPDH. Synthetic peptide located within the following region: SDVSVVRRTQRYLYENLEESPVQYAAYVTVGGITSVIKLMFAGLFFLFFV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name saccharopine dehydrogenase (putative)
Background SCCPDH belongs to the saccharopine dehydrogenase family. The exact function of SCCPDH remains unknown.
Synonyms CGI-49; NET11
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.