Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SDF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF4 antibody: synthetic peptide directed towards the C terminal of human SDF4. Synthetic peptide located within the following region: KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA |
Rabbit Polyclonal Anti-SDF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF4 antibody: synthetic peptide directed towards the middle region of human SDF4. Synthetic peptide located within the following region: KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE |
Goat Anti-SDF4 (aa161-175), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EYKVKFLASKGHSEK., from the internal region of the protein sequence according to NP_057631.1; NP_057260.2. |
SDF4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SDF4 |
SDF4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SDF4 (NP_057260.2). |
| Modifications | Unmodified |
SDF4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SDF4 (NP_057260.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SDF4