SDF4 Rabbit Polyclonal Antibody

CAT#: TA342002

Rabbit Polyclonal Anti-SDF4 Antibody

Product Images

WB Suggested Anti-SDF4 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SDF4 antibody: synthetic peptide directed towards the C terminal of human SDF4. Synthetic peptide located within the following region: KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: stromal cell derived factor 4
• Database Link:
  NP_057631
  Entrez Gene 51150 Human
  UniProt ID Q9BRK5
• Background: This gene encodes a stromal cell derived factor that is a member ofThe CREC protein family.The encoded protein contains six EF-hand motifs and calcium-binding motifs.This protein localizes toThe Golgi lumen and may be involved in regulating calcium dependent cellular activities. [provided by RefSeq, Sep 2011]
• Synonyms: Cab45; SDF-4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Goat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane