Antibodies

Jump to Filters
View as table Download
RDHE2 (SDR16C5) (Center) Rabbit Polyclonal Antibody
AP53825PU-N

USD 450.00

2 Weeks

RDHE2 (SDR16C5) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 122-151 amino acids from the Central region of Human SDR16C5.
RDHE2 (SDR16C5) Rabbit Polyclonal Antibody
TA340321

USD 375.00

5 Days

Rabbit Polyclonal Anti-SDR16C5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDR16C5 antibody: synthetic peptide directed towards the middle region of human SDR16C5. Synthetic peptide located within the following region: AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT