RDHE2 (SDR16C5) Rabbit Polyclonal Antibody

CAT#: TA340321

Rabbit Polyclonal Anti-SDR16C5 Antibody

Product Images

WB Suggested Anti-SDR16C5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SDR16C5 antibody: synthetic peptide directed towards the middle region of human SDR16C5. Synthetic peptide located within the following region: AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: short chain dehydrogenase/reductase family 16C, member 5
• Database Link:
  NP_620419
  Entrez Gene 195814 Human
  UniProt ID Q8N3Y7
• Background: The specific function of SDR16C5 is not yet known.SDR16C5 belongs to a family of short-chain alcohol dehydrogenases/reductases that catalyze the first and rate-limiting step that generates retinaldehyde from retinol (Matsuzaka et al., 2002 [PubMed 12372410]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-454 AB083038.1 1-454 455-1307 AK095159.1 549-1401 1308-2860 BC037219.1 749-2301 2861-3039 BC037219.1 2303-2481
• Synonyms: RDH#2; RDH-E2; RDHE2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome