SEMA4B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SEMA4B antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human SEMA4B. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (94%); Marmoset, Elephant, Horse (88%); Dog (81%). |
SEMA4B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SEMA4B antibody was raised against synthetic 17 amino acid peptide from internal region of human SEMA4B. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset, Hamster (88%); Elephant, Rabbit (82%). |
SEMA4B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | SEMA4B antibody was raised against synthetic 19 amino acid peptide from internal region of human SEMA4B. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (89%). |
Rabbit Polyclonal Anti-SEMA4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEMA4B antibody: synthetic peptide directed towards the N terminal of human SEMA4B. Synthetic peptide located within the following region: KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS |
Germany
Japan
United Kingdom
China
