SEMA4B Rabbit Polyclonal Antibody

CAT#: TA338408

Rabbit Polyclonal Anti-SEMA4B Antibody

Product Images

WB Suggested Anti-SEMA4B Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEMA4B antibody: synthetic peptide directed towards the N terminal of human SEMA4B. Synthetic peptide located within the following region: KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: semaphorin 4B
• Database Link:
  NP_064595
  Entrez Gene 10509 Human
  UniProt ID Q9NPR2
• Background: SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
• Synonyms: SEMAC; SemC
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Axon guidance