Antibodies

View as table Download

Rabbit Polyclonal Anti-SERPINA11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINA11 antibody is: synthetic peptide directed towards the middle region of Human SERPINA11. Synthetic peptide located within the following region: TFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHR

Rabbit Polyclonal Anti-SERPINA11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SERPINA11

SERPINA11 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SERPINA11