Antibodies

Jump to Filters
View as table Download
SERPINA11 Rabbit Polyclonal Antibody
TA334832

USD 375.00

5 Days

Rabbit Polyclonal Anti-SERPINA11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINA11 antibody is: synthetic peptide directed towards the middle region of Human SERPINA11. Synthetic peptide located within the following region: TFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHR
SERPINA11 Rabbit Polyclonal Antibody
TA351656

USD 345.00

In Stock

Rabbit Polyclonal Anti-SERPINA11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SERPINA11
SERPINA11 Rabbit Polyclonal Antibody
TA367249

USD 380.00

4 Weeks

SERPINA11 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SERPINA11