SERPINA11 Rabbit Polyclonal Antibody

CAT#: TA334832

Rabbit Polyclonal Anti-SERPINA11 Antibody

Product Images

Host: Rabbit; Target Name: SERPINA11; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERPINA11 antibody is: synthetic peptide directed towards the middle region of Human SERPINA11. Synthetic peptide located within the following region: TFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: serpin family A member 11
• Database Link:
  NP_001073920
  Entrez Gene 256394 Human
  UniProt ID Q86U17
• Background: The function of this protein remains unknown.
• Synonyms: antiproteinase-like 2; antitrypsin); clade A (alpha-1 antiproteinase; member 11; serine (or cysteine) proteinase inhibitor; serpin peptidase inhibitor
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 83%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein