Antibodies

Jump to Filters
View as table Download
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA344047

USD 410.00

5 Days

Rabbit Polyclonal Anti-SF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF1 antibody: synthetic peptide directed towards the N terminal of human SF1. Synthetic peptide located within the following region: NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA314682

USD 345.00

In Stock

Rabbit polyclonal SF1 (Ab-82) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human SF1 around the phosphorylation site of serine 82 (S-P-SP-P-E).
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA314683

USD 345.00

In Stock

Rabbit polyclonal SF1 (Ser82) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SF1 around the phosphorylation site of serine 82 (S-P-SP-P-E).
Modifications Phospho-specific
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA344045

USD 475.00

5 Days

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF1 antibody: synthetic peptide directed towards the C terminal of human SF1. Synthetic peptide located within the following region: MASSTPLPWQQNTTTTTTSAGTGSIPPWQQQQAAAAASPGAPQMQGNPTM
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA344046

USD 475.00

5 Days

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF1 antibody: synthetic peptide directed towards the C terminal of human SF1. Synthetic peptide located within the following region: APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA333964

USD 375.00

5 Days

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SF1 Antibody: synthetic peptide directed towards the N terminal of human SF1. Synthetic peptide located within the following region: LRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLIT
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA333965

USD 375.00

5 Days

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SF1 Antibody: synthetic peptide directed towards the middle region of human SF1. Synthetic peptide located within the following region: VKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRP
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA343481

USD 375.00

5 Days

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF1 antibody: synthetic peptide directed towards the N terminal of human SF1. Synthetic peptide located within the following region: ATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERA
splicing factor 1 (SF1) Mouse Monoclonal Antibody [Clone ID: OTI7H9]
CF809477

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) SF1 mouse monoclonal antibody,clone OTI7H9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
TA381416

USD 275.00

3 Weeks

SF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human SF1 (NP_973727.1).
Modifications Unmodified