Germany
Japan
United Kingdom
China
splicing factor 1 (SF1) Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 1
USD 605.00
Other products for "SF1"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SF1 antibody: synthetic peptide directed towards the N terminal of human SF1. Synthetic peptide located within the following region: NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 68 kDa |
| Gene Name | splicing factor 1 |
| Database Link | |
| Background | SF1 contains 1 KH domain and 1 CCHC-type zinc finger. It is necessary for the ATP-dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. It may act as transcription repressor. |
| Synonyms | BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.