Rabbit Polyclonal Anti-SFRS8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8. Synthetic peptide located within the following region: LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE |
Rabbit Polyclonal Anti-SFRS8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8. Synthetic peptide located within the following region: MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER |
SFRS8 (SFSWAP) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SFRS8 |
SFSWAP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-280 of human SFSWAP (NP_004583.2). |
Germany
Japan
United Kingdom
China